2.20 Rating by ClearWebStats
abdullahblog.com is 4 years 11 months 3 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, abdullahblog.com is SAFE to browse.
Get Custom Widget

Traffic Report of Abdullahblog

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View abdullahblog.com site advisor rating Not Applicable

Where is abdullahblog.com server located?

Hosted IP Address:

143.95.225.99 View other site hosted with abdullahblog.com

Hosted Country:

abdullahblog.com hosted country US abdullahblog.com hosted country

Location Latitude:

34.0549

Location Longitude:

-118.2578

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View abdullahblog.com HTML resources

Homepage Links Analysis

Abdullah Saeed – All the latest article

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 143.95.225.99)

Antalya Adaklık Kurbanlık - 7/24 İletişim İçin 0553 402 0740

abdullahblog.com favicon - antalya-adaklikkurbanlik.com

View abdullahblog.com Pagerank   abdullahblog.com alexa rank Not Applicable   abdullahblog.com website value $ 8.95

Antalya En Yakın Lastikçi - 7/24 Mobil Lastikçi 0 542 611 69 87 Arayın

abdullahblog.com favicon - antalyaenyakinlastikci.com

View abdullahblog.com Pagerank   abdullahblog.com alexa rank Not Applicable   abdullahblog.com website value $ 8.95

Index of /

abdullahblog.com favicon - spredtechnologies.com

View abdullahblog.com Pagerank   abdullahblog.com alexa rank Not Applicable   abdullahblog.com website value $ 8.95

Antalya Sepetli Vinç Kiralama - İletişim İçin : 0543 875 3833

abdullahblog.com favicon - antalyaenessepetlivinckiralama.com

View abdullahblog.com Pagerank   abdullahblog.com alexa rank Not Applicable   abdullahblog.com website value $ 8.95

KGN Travels - Coming Soon

abdullahblog.com favicon - kgntravels.lk

View abdullahblog.com Pagerank   abdullahblog.com alexa rank Not Applicable   abdullahblog.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.16.0
Date: Wed, 22 May 2019 19:20:03 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link: <http://abdullahblog.com/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip

Domain Information for abdullahblog.com

Domain Registrar: TUCOWS DOMAINS INC. abdullahblog.com registrar info
Registration Date: 2019-05-20 4 years 11 months 3 weeks ago
Last Modified: 2019-05-20 4 years 11 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns3.maxease.com abdullahblog.com name server information 143.95.41.115 abdullahblog.com server is located in United States United States
ns4.maxease.com abdullahblog.com name server information 65.75.128.93 abdullahblog.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
abdullahblog.com A 21598 IP:143.95.225.99
abdullahblog.com NS 21599 Target:ns3.maxease.com
abdullahblog.com NS 21599 Target:ns4.maxease.com
abdullahblog.com SOA 21599 MNAME:ns3.maxease.com
RNAME:tahirmughal.maxease.com
Serial:2019052002
Refresh:86400
Retry:7200
Expire:3600000
abdullahblog.com MX 21599 Target:mail.abdullahblog.com
abdullahblog.com TXT 21599 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to Abdullahblog

Google

abdullahblog.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View abdullahblog.com Pagerank   Alexa rank for abdullahblog.com 1   website value of abdullahblog.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

abdullahblog.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View abdullahblog.com Pagerank   Alexa rank for abdullahblog.com 1   website value of abdullahblog.com $ 8,833,062,960.00

Gmail

abdullahblog.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View abdullahblog.com Pagerank   Alexa rank for abdullahblog.com 1   website value of abdullahblog.com $ 8,833,062,960.00

Android Apps on Google Play

abdullahblog.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View abdullahblog.com Pagerank   Alexa rank for abdullahblog.com 1   website value of abdullahblog.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

abdullahblog.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View abdullahblog.com Pagerank   Alexa rank for abdullahblog.com 1   website value of abdullahblog.com $ 8,833,062,960.00

Full WHOIS Lookup for abdullahblog.com

Domain Name: ABDULLAHBLOG.COM
Registry Domain ID: 2392856750_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2019-05-20T16:48:19Z
Creation Date: 2019-05-20T16:41:23Z
Registry Expiry Date: 2020-05-20T16:41:23Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS3.MAXEASE.COM
Name Server: NS4.MAXEASE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-22T19:19:53Z