Web stats for Abdullahblog - abdullahblog.com
2.20 Rating by ClearWebStats
abdullahblog.com is 4 years 11 months 3 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, abdullahblog.com is SAFE to browse.
Traffic Report of Abdullahblog
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is abdullahblog.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 1 |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 1 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 143.95.225.99)
Antalya Adaklık Kurbanlık - 7/24 İletişim İçin 0553 402 0740
- antalya-adaklikkurbanlik.com
Antalya En Yakın Lastikçi - 7/24 Mobil Lastikçi 0 542 611 69 87 Arayın
- antalyaenyakinlastikci.com
Antalya Sepetli Vinç Kiralama - İletişim İçin : 0543 875 3833
- antalyaenessepetlivinckiralama.com
HTTP Header Analysis
HTTP/1.1 200 OK
Server: nginx/1.16.0
Date: Wed, 22 May 2019 19:20:03 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link: <http://abdullahblog.com/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip
Server: nginx/1.16.0
Date: Wed, 22 May 2019 19:20:03 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link: <http://abdullahblog.com/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip
Domain Information for abdullahblog.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
abdullahblog.com | A | 21598 |
IP:143.95.225.99 |
abdullahblog.com | NS | 21599 |
Target:ns3.maxease.com |
abdullahblog.com | NS | 21599 |
Target:ns4.maxease.com |
abdullahblog.com | SOA | 21599 |
MNAME:ns3.maxease.com RNAME:tahirmughal.maxease.com Serial:2019052002 Refresh:86400 Retry:7200 Expire:3600000 |
abdullahblog.com | MX | 21599 |
Target:mail.abdullahblog.com |
abdullahblog.com | TXT | 21599 |
TXT:v=spf1 a mx include:websitewelcome.com ~all |
Similarly Ranked Websites to Abdullahblog
- google.com
Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.
Google Calendar - Sign in to Access & Edit Your Schedule
- calendar.google.com
Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).
Gmail
- mail.google.com
Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.
Android Apps on Google Play
- play.google.com
Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.
Google Chrome - Download the Fast, Secure Browser from Google
- chrome.google.com
Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.
Full WHOIS Lookup for abdullahblog.com
Domain Name: ABDULLAHBLOG.COM
Registry Domain ID: 2392856750_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2019-05-20T16:48:19Z
Creation Date: 2019-05-20T16:41:23Z
Registry Expiry Date: 2020-05-20T16:41:23Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS3.MAXEASE.COM
Name Server: NS4.MAXEASE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-22T19:19:53Z
Registry Domain ID: 2392856750_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2019-05-20T16:48:19Z
Creation Date: 2019-05-20T16:41:23Z
Registry Expiry Date: 2020-05-20T16:41:23Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS3.MAXEASE.COM
Name Server: NS4.MAXEASE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-22T19:19:53Z